Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
High-quality illustration prints
Prints
[Defected] Initial R - A4 Print
[Defected] Initial R - A4 Print
4,00 €
3 - A5 & A4 prints
3 - A5 & A4 prints
5,00 €
DIO - A5 Print
DIO - A5 Print
5,00 €
Funny Love - A5 Print
Funny Love - A5 Print
5,00 €
Golden Wind - JoJo's Bizarre Adventure
Golden Wind - JoJo's Bizarre Adventure
5,00 €
It's Tim Time! - A5 & A4 prints
It's Tim Time! - A5 & A4 prints
5,00 €
Let's Pop Together - Pop Team Epic
Let's Pop Together - Pop Team Epic
5,00 €
Marina - Splatoon 2
Marina - Splatoon 2
5,00 €
Ninja Team Selfie Time - Mystical Ninja
Ninja Team Selfie Time - Mystical Ninja
5,00 €
Red - portrait painting
Red - portrait painting
5,00 €
Rose - A5 & A4 prints
Rose - A5 & A4 prints
5,00 €
Sailor V
Sailor V
5,00 €
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i