EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
It's Tim Time! - A5 & A4 prints
It's Tim Time! - A5 & A4 prints

It's Tim Time! - A5 & A4 prints

Units in Stock 12
5,00 € inc. tax
The show is about to begin with Balan and Tim! Illustrated in 2020 using Clip Studio Paint on a Samsung Galaxy TAB S4.

Available in A4 and A5 size. Printed on 200gsm satin paper. Each print comes with a personalized thank you card.
Product Code: 9iuw7YA
weight: 51.0 g
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews
write review
Print received
5/5
Eric Crowley
Fantastic quality and arrived on time ️ Little stickers as an extra were very thoughtful Hayley. You go the extra mile for your customers will buy again soon .
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i