Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
Key-rings, badges and stickers
Accessories
2018 GP All-Star Keyrings
2018 GP All-Star Keyrings
2,40 €
2019 GP All-stars Button Badges
2019 GP All-stars Button Badges
2,40 €
Matryoshka'Mon - Stickers
Matryoshka'Mon - Stickers
3,00 €
Morioh Kids - Stickers
Morioh Kids - Stickers
3,00 €
PAPAYA BOYS - Holographic Stickers
PAPAYA BOYS - Holographic Stickers
3,00 €
Pride Livery Stickers
Pride Livery Stickers
5,00 €
Video Game Badge Collection Vol. 1
Video Game Badge Collection Vol. 1
2,00 €
WAH BROS. - Button Badges
WAH BROS. - Button Badges
2,00 €
WAH BROS. - Stickers
WAH BROS. - Stickers
3,00 €
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i