EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
PAPAYA BOYS - Holographic Stickers
PAPAYA BOYS - Holographic Stickers PAPAYA BOYS - Holographic Stickers

PAPAYA BOYS - Holographic Stickers

Units in Stock 15
3,00 € inc. tax
They're the talk of the 2019 season! Show your support for the Papaya Boys with these new holographic stickers, perfect to stick anywhere!

The Lando sticker is 2.7" X 3.5" and Carlos comes in 2.9" X 3.5". Printed by StickerApp, these stickers are PET laminate with UV screening to protect from weather and sunlight, they have a 2-4 year outdoor life and are a PVC free product.

Each sticker comes with a hand-drawn thank you card.
Product Code: TkcquGQ
weight: 1 g
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews

No Reviews Posted Yet - be the first!

write review
Related Products
Pride Livery Stickers
Pride Livery Stickers
5,00 €
2019 GP All-stars Butto..
2019 GP All-stars Butto..
2,40 €
2018 GP All-Star Keyrings
2018 GP All-Star Keyrings
2,40 €
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i