EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
2019 GP All-stars Button Badges
2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges 2019 GP All-stars Button Badges

2019 GP All-stars Button Badges

Units in Stock 27
RRP 3,00 €
2,40 € inc. tax
All new chibi GP designs for the 2019! Get your favourite drivers and show your support! These are hand-assembled button badges that are 38mm in diameter and are perfect for bags, jackets, hats and more! All the current 2019 grid is now available, including updated designs for 23 and 10.

Each order comes with a hand-drawn persoanlised thank you card.
Product Code: gGxi4f6
weight: 30 g
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews

No Reviews Posted Yet - be the first!

write review
Related Products
2018 GP All-Star Keyrings
2018 GP All-Star Keyrings
2,40 €
PAPAYA BOYS - Holograph..
PAPAYA BOYS - Holograph..
3,00 €
Pride Livery Stickers
Pride Livery Stickers
5,00 €
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i